ATG4C (NM_178221) Human Mass Spec Standard
CAT#: PH305955
ATG4C MS Standard C13 and N15-labeled recombinant protein (NP_835739)
View other "ATG4C" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ATG4C MS Standard C13 and N15-labeled recombinant protein (NP_835739) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205955 |
Predicted MW | 52.3 kDa |
Protein Sequence |
>RC205955 representing NM_178221
Red=Cloning site Green=Tags(s) MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDH VIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALN IENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLA LFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMT SDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQ SFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVN GHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_835739 |
RefSeq Size | 1774 |
RefSeq ORF | 1374 |
Synonyms | APG4-C; APG4C; AUTL1; AUTL3 |
Locus ID | 84938 |
Cytogenetics | 1p31.3 |
Summary | Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding the same protein, have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Protease |
Protein Pathways | Regulation of autophagy |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403599 | ATG4C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409886 | ATG4C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403599 | Transient overexpression lysate of ATG4 autophagy related 4 homolog C (S. cerevisiae) (ATG4C), transcript variant 8 |
CNY 3,080.00 |
|
LY409886 | Transient overexpression lysate of ATG4 autophagy related 4 homolog C (S. cerevisiae) (ATG4C), transcript variant 7 |
CNY 3,080.00 |
|
PH316088 | ATG4C MS Standard C13 and N15-labeled recombinant protein (NP_116241) |
CNY 19,520.00 |
|
TP305955 | Recombinant protein of human ATG4 autophagy related 4 homolog C (S. cerevisiae) (ATG4C), transcript variant 8, 20 µg |
CNY 2,900.00 |
|
TP316088 | Recombinant protein of human ATG4 autophagy related 4 homolog C (S. cerevisiae) (ATG4C), transcript variant 7, 20 µg |
CNY 2,900.00 |