KTEL1 (POGLUT1) (NM_152305) Human Mass Spec Standard
CAT#: PH305992
KTELC1 MS Standard C13 and N15-labeled recombinant protein (NP_689518)
View other "KTEL1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | KTELC1 MS Standard C13 and N15-labeled recombinant protein (NP_689518) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205992 |
Predicted MW | 46.2 kDa |
Protein Sequence |
>RC205992 protein sequence
Red=Cloning site Green=Tags(s) MEWWASSPLRLWLLLFLLPSAQGRQKESGSKWKVFIDQINRSLENYEPCSSQNCSCYHGVIEEDLTPFRG GISRRMMAEVVRRKLGTHYQITKNRLYRENDCMFPSRCSGVEHFILEVIGRLPDMEMVINVRDYPQVPKW MEPAIPVFSFSKTSEYHDIMYPAWTFWEGGPAVWPIYPTGLGRWDLFREDLVRSAAQWPWKKKNSTAYFR GSRTSPERDPLILLSRKNTKLVDAEYTKNQAWKSMKDTLGKPAAKDVHLVDHCKYKYLFNFRGVAASFRF KHLFLCGSLVFHVGDEWLEFFYPQLKPWVHYIPVKTDLSNVQELLQFVKANDDVAQEIAERGSQFIRNHL QMDDITCYWENLLSEYSKFLSYNVTRRKGYDQIIPKMLKTEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_689518 |
RefSeq Size | 3552 |
RefSeq ORF | 1176 |
Synonyms | C3orf9; CLP46; hCLP46; KDELCL1; KTELC1; LGMD2Z; LGMDR21; MDS010; MDSRP; Rumi |
Locus ID | 56983 |
Cytogenetics | 3q13.33 |
Summary | This gene encodes a protein with both O-glucosyltransferase and O-xylosyltransferase activity which localizes to the lumen of the endoplasmic reticulum. This protein has a carboxy-terminal KTEL motif which is predicted to function as an endoplasmic reticulum retention signal. This gene is an essential regulator of Notch signalling and likely plays a role in cell fate and tissue formation during development. It may also play a role in the pathogenesis of leukemia. Mutations in this gene have been associated with the autosomal dominant genodermatosis Dowling-Degos disease 4. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407662 | POGLUT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407662 | Transient overexpression lysate of KTEL (Lys-Tyr-Glu-Leu) containing 1 (KTELC1), transcript variant 1 |
CNY 3,080.00 |
|
TP305992 | Recombinant protein of human KTEL (Lys-Tyr-Glu-Leu) containing 1 (KTELC1), transcript variant 1, 20 µg |
CNY 2,900.00 |