THAP1 (NM_018105) Human Mass Spec Standard
CAT#: PH306000
THAP1 MS Standard C13 and N15-labeled recombinant protein (NP_060575)
View other "THAP1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | THAP1 MS Standard C13 and N15-labeled recombinant protein (NP_060575) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206000 |
Predicted MW | 24.9 kDa |
Protein Sequence |
>RC206000 protein sequence
Red=Cloning site Green=Tags(s) MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNK LLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVE DTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVE VPA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060575 |
RefSeq Size | 2189 |
RefSeq ORF | 639 |
Synonyms | DYT6 |
Locus ID | 55145 |
Cytogenetics | 8p11.21 |
Summary | The protein encoded by this gene contains a THAP domain, a conserved DNA-binding domain. This protein colocalizes with the apoptosis response protein PAWR/PAR-4 in promyelocytic leukemia (PML) nuclear bodies, and functions as a proapoptotic factor that links PAWR to PML nuclear bodies. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404715 | THAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413231 | THAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404715 | Transient overexpression lysate of THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 2 |
CNY 3,080.00 |
|
LY413231 | Transient overexpression lysate of THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 1 |
CNY 3,080.00 |
|
TP306000 | Recombinant protein of human THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 1, 20 µg |
CNY 2,900.00 |