EXOSC1 (NM_016046) Human Mass Spec Standard
CAT#: PH306007
EXOSC1 MS Standard C13 and N15-labeled recombinant protein (NP_057130)
View other "EXOSC1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | EXOSC1 MS Standard C13 and N15-labeled recombinant protein (NP_057130) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206007 |
Predicted MW | 21.5 kDa |
Protein Sequence |
>RC206007 protein sequence
Red=Cloning site Green=Tags(s) MAPPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFSSLAGCLMKSSENGALPVVSVVRETESQLLPDVGAI VTCKVSSINSRFAKVHILYVGSMPLKNSFRGTIRKEDVRATEKDKVEIYKSFRPGDIVLAKVISLGDAQS NYLLTTAENELGVVVAHSESGIQMVPISWCEMQCPKTHTKEFRKVARVQPEFLQT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057130 |
RefSeq Size | 1150 |
RefSeq ORF | 585 |
Synonyms | CGI-108; CSL4; Csl4p; p13; PCH1F; SKI4; Ski4p |
Locus ID | 51013 |
Cytogenetics | 10q24.1 |
Summary | This gene encodes a core component of the exosome. The mammalian exosome is required for rapid degradation of AU rich element-containing RNAs but not for poly(A) shortening. The association of this protein with the exosome is mediated by protein-protein interactions with ribosomal RNA-processing protein 42 and ribosomal RNA-processing protein 46. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
Protein Pathways | RNA degradation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414227 | EXOSC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414227 | Transient overexpression lysate of exosome component 1 (EXOSC1) |
CNY 3,080.00 |
|
TP306007 | Recombinant protein of human exosome component 1 (EXOSC1), 20 µg |
CNY 2,900.00 |