LTC4S (NM_145867) Human Mass Spec Standard
CAT#: PH306062
LTC4S MS Standard C13 and N15-labeled recombinant protein (NP_665874)
View other "LTC4S" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | LTC4S MS Standard C13 and N15-labeled recombinant protein (NP_665874) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206062 |
Predicted MW | 16.5 kDa |
Protein Sequence |
>RC206062 protein sequence
Red=Cloning site Green=Tags(s) MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVA GIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALL GQLRTLLPWA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_665874 |
RefSeq Size | 680 |
RefSeq ORF | 450 |
Locus ID | 4056 |
Cytogenetics | 5q35.3 |
Summary | The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Arachidonic acid metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407849 | LTC4S HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407849 | Transient overexpression lysate of leukotriene C4 synthase (LTC4S) |
CNY 3,080.00 |
|
TP306062 | Recombinant protein of human leukotriene C4 synthase (LTC4S), 20 µg |
CNY 2,900.00 |