CPEB1 (NM_001079535) Human Mass Spec Standard
CAT#: PH306406
CPEB1 MS Standard C13 and N15-labeled recombinant protein (NP_001073003)
View other "CPEB1" proteins (12)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CPEB1 MS Standard C13 and N15-labeled recombinant protein (NP_001073003) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206406 |
Predicted MW | 53.6 kDa |
Protein Sequence |
>RC206406 protein sequence
Red=Cloning site Green=Tags(s) MLFPTSAQESSRGLPDANDLCLGLQSLSLTGWDRPWSTQDSDSSAQSSTHSVLSMLHNPLGNVLGKPPLS FLPLDPLGSDLVDKFPAPSVRGSRLDTRPILDSRSSSPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLS LSGGGPRDPLKMGVGSRMDQEQAALAAVTPSPTSASKRWPGASVWPSWDLLEAPKDPFSIEREARLHRQA AAVNEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKG YVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSR TVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKF TKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQKNRDSS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001073003 |
RefSeq Size | 3196 |
RefSeq ORF | 1458 |
Synonyms | CPE-BP1; CPEB; CPEB-1; h-CPEB; hCPEB-1 |
Locus ID | 64506 |
Cytogenetics | 15q25.2 |
Summary | This gene encodes a member of the cytoplasmic polyadenylation element binding protein family. This highly conserved protein binds to a specific RNA sequence, called the cytoplasmic polyadenylation element, found in the 3' untranslated region of some mRNAs. The encoded protein functions in both the cytoplasm and the nucleus. It is involved in the regulation of mRNA translation, as well as processing of the 3' untranslated region, and may play a role in cell proliferation and tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014] |
Protein Pathways | Dorso-ventral axis formation, Oocyte meiosis, Progesterone-mediated oocyte maturation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410792 | CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421521 | CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC421522 | CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC421523 | CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410792 | Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 1 |
CNY 3,080.00 |
|
LY421521 | Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 2 |
CNY 4,840.00 |
|
LY421522 | Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 4 |
CNY 4,840.00 |
|
LY421523 | Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 3 |
CNY 3,080.00 |
|
PH313337 | CPEB1 MS Standard C13 and N15-labeled recombinant protein (NP_001073002) |
CNY 19,520.00 |
|
TP306406 | Recombinant protein of human cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP313337 | Recombinant protein of human cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP761390 | Purified recombinant protein of Human cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |