RABIF (NM_002871) Human Mass Spec Standard
CAT#: PH306632
RABIF MS Standard C13 and N15-labeled recombinant protein (NP_002862)
View other "RABIF" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RABIF MS Standard C13 and N15-labeled recombinant protein (NP_002862) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206632 |
Predicted MW | 13.8 kDa |
Protein Sequence |
>RC206632 protein sequence
Red=Cloning site Green=Tags(s) MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWL VEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002862 |
RefSeq Size | 3227 |
RefSeq ORF | 369 |
Synonyms | MSS4; RASGFR3; RASGRF3 |
Locus ID | 5877 |
Cytogenetics | 1q32.1 |
Summary | This gene encodes a member of the SCE4/YPT1/RAB family of small GTP-binding proteins that are involved in the regulation of intracellular vesicular transport. This protein stimulates GTP-GDP exchange in SEC4, and to a lesser extent in YPT1 and RAB3A, and may play a general role in vesicular transport. [provided by RefSeq, Oct 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419050 | RABIF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419050 | Transient overexpression lysate of RAB interacting factor (RABIF) |
CNY 3,080.00 |
|
TP306632 | Recombinant protein of human RAB interacting factor (RABIF), 20 µg |
CNY 2,900.00 |