Troponin C1 (TNNC1) (NM_003280) Human Mass Spec Standard
CAT#: PH307014
TNNC1 MS Standard C13 and N15-labeled recombinant protein (NP_003271)
View other "Troponin C1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | TNNC1 MS Standard C13 and N15-labeled recombinant protein (NP_003271) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207014 |
Predicted MW | 18.4 kDa |
Protein Sequence |
>RC207014 protein sequence
Red=Cloning site Green=Tags(s) MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSG TVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDG DKNNDGRIDYDEFLEFMKGVE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003271 |
RefSeq Size | 705 |
RefSeq ORF | 483 |
Synonyms | CMD1Z; CMH13; TN-C; TNC; TNNC |
Locus ID | 7134 |
Cytogenetics | 3p21.1 |
Summary | Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. The binding of calcium to TnC abolishes the inhibitory action of TnI, thus allowing the interaction of actin with myosin, the hydrolysis of ATP, and the generation of tension. Mutations in this gene are associated with cardiomyopathy dilated type 1Z. [provided by RefSeq, Oct 2008] |
Protein Pathways | Calcium signaling pathway, Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401131 | TNNC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401131 | Transient overexpression lysate of troponin C type 1 (slow) (TNNC1) |
CNY 3,080.00 |
|
TP307014 | Recombinant protein of human troponin C type 1 (slow) (TNNC1), 20 µg |
CNY 2,900.00 |
|
TP710218 | Purified recombinant protein of Human troponin C type 1 (slow) (TNNC1), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
其它Troponin C1产品