CLEC4D (NM_080387) Human Mass Spec Standard
CAT#: PH307032
CLEC4D MS Standard C13 and N15-labeled recombinant protein (NP_525126)
View other "CLEC4D" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CLEC4D MS Standard C13 and N15-labeled recombinant protein (NP_525126) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207032 |
Predicted MW | 24.7 kDa |
Protein Sequence |
>RC207032 protein sequence
Red=Cloning site Green=Tags(s) MGLEKPQSKLEGGMHPQLIPSVIAVVFILLLSVCFIASCLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEK SELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLS YFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIP GTTLN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_525126 |
RefSeq Size | 1973 |
RefSeq ORF | 645 |
Synonyms | CD368; CLEC-6; CLEC6; CLECSF8; Dectin-3; MCL; MPCL |
Locus ID | 338339 |
Cytogenetics | 12p13.31 |
Summary | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409180 | CLEC4D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409180 | Transient overexpression lysate of C-type lectin domain family 4, member D (CLEC4D) |
CNY 3,080.00 |
|
TP307032 | Recombinant protein of human C-type lectin domain family 4, member D (CLEC4D), 20 µg |
CNY 2,900.00 |