JNK3 (MAPK10) (NM_002753) Human Mass Spec Standard
CAT#: PH307216
MAPK10 MS Standard C13 and N15-labeled recombinant protein (NP_002744)
View other "JNK3" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
Product Data | |
Description | MAPK10 MS Standard C13 and N15-labeled recombinant protein (NP_002744) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207216 |
Predicted MW | 48.4 kDa |
Protein Sequence |
>RC207216 representing NM_002753
Red=Cloning site Green=Tags(s) MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPI GSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQ DVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGL ARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLG TPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISV DDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSAQV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002744 |
RefSeq Size | 2372 |
RefSeq ORF | 1266 |
Synonyms | JNK3; JNK3A; p54bSAPK; p493F12; PRKM10; SAPK1b |
Locus ID | 5602 |
Cytogenetics | 4q21.3 |
Summary | The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as integration points for multiple biochemical signals, and thus are involved in a wide variety of cellular processes, such as proliferation, differentiation, transcription regulation and development. This kinase is specifically expressed in a subset of neurons in the nervous system, and is activated by threonine and tyrosine phosphorylation. Targeted deletion of this gene in mice suggests that it may have a role in stress-induced neuronal apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. A recent study provided evidence for translational readthrough in this gene, and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon. [provided by RefSeq, Dec 2017] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Adipocytokine signaling pathway, Colorectal cancer, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Fc epsilon RI signaling pathway, Focal adhesion, GnRH signaling pathway, Insulin signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Pancreatic cancer, Pathways in cancer, Progesterone-mediated oocyte maturation, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway, Type II diabetes mellitus, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403373 | MAPK10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC419129 | MAPK10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403373 | Transient overexpression lysate of mitogen-activated protein kinase 10 (MAPK10), transcript variant 2 |
CNY 4,840.00 |
|
LY419129 | Transient overexpression lysate of mitogen-activated protein kinase 10 (MAPK10), transcript variant 1 |
CNY 3,080.00 |
|
PH317188 | MAPK10 MS Standard C13 and N15-labeled recombinant protein (NP_620448) |
CNY 19,520.00 |
|
TP307216 | Recombinant protein of human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP317188 | Recombinant protein of human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP760300 | Recombinant protein of human mitogen-activated protein kinase 10 (MAPK10), transcript variant 4, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 1,940.00 |