UBE2D2 (NM_181838) Human Mass Spec Standard
CAT#: PH307283
UBE2D2 MS Standard C13 and N15-labeled recombinant protein (NP_862821)
View other "UBE2D2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | UBE2D2 MS Standard C13 and N15-labeled recombinant protein (NP_862821) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207283 |
Predicted MW | 13.5 kDa |
Protein Sequence |
>RC207283 representing NM_181838
Red=Cloning site Green=Tags(s) MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE WTQKYAM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_862821 |
RefSeq Size | 2879 |
RefSeq ORF | 441 |
Synonyms | E2(17)KB2; PUBC1; UBC4; UBC4/5; UBCH4; UBCH5B |
Locus ID | 7322 |
Cytogenetics | 5q31.2 |
Summary | Regulated degradation of misfolded, damaged or short-lived proteins in eukaryotes occurs via the ubiquitin (Ub)-proteasome system (UPS). An integral part of the UPS system is the ubiquitination of target proteins and covalent linkage of Ub-containing proteins to form polymeric chains, marking them as targets for 26S proteasome-mediated degradation. Ubiquitination of proteins is mediated by a cascade of enzymes which includes E1 (ubiquitin activating), E2 (ubiquitin conjugating), and E3 (ubiquitin ligases) enzymes. This gene encodes a member of the E2 enzyme family. Substrates of this enzyme include the tumor suppressor protein p53 and peroxisomal biogenesis factor 5 (PEX5). Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405611 | UBE2D2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418757 | UBE2D2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405611 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2), transcript variant 2 |
CNY 3,080.00 |
|
LY418757 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2), transcript variant 1 |
CNY 3,080.00 |
|
PH318795 | UBE2D2 MS Standard C13 and N15-labeled recombinant protein (NP_003330) |
CNY 19,520.00 |
|
TP307283 | Recombinant protein of human ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP318795 | Recombinant protein of human ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2), transcript variant 1, 20 µg |
CNY 2,900.00 |