TAF7 (NM_005642) Human Mass Spec Standard
CAT#: PH307437
TAF7 MS Standard C13 and N15-labeled recombinant protein (NP_005633)
View other "TAF7" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TAF7 MS Standard C13 and N15-labeled recombinant protein (NP_005633) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207437 |
Predicted MW | 40.3 kDa |
Protein Sequence |
>RC207437 protein sequence
Red=Cloning site Green=Tags(s) MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDL PCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPL KNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQG HDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMG IQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005633 |
RefSeq Size | 2310 |
RefSeq ORF | 1047 |
Synonyms | TAF2F; TAFII55 |
Locus ID | 6879 |
Cytogenetics | 5q31.3 |
Summary | The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | Basal transcription factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417173 | TAF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417173 | Transient overexpression lysate of TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa (TAF7) |
CNY 3,080.00 |
|
TP307437 | Recombinant protein of human TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa (TAF7), 20 µg |
CNY 2,900.00 |