FKBP6 (NM_003602) Human Mass Spec Standard
CAT#: PH307712
FKBP6 MS Standard C13 and N15-labeled recombinant protein (NP_003593)
View other "FKBP6" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FKBP6 MS Standard C13 and N15-labeled recombinant protein (NP_003593) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207712 |
Predicted MW | 37.2 kDa |
Protein Sequence |
>RC207712 protein sequence
Red=Cloning site Green=Tags(s) MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYSGYLEHMDR PFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELL DFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNYLFRQNRFYDAKVRYKRALLLLRRRSAPPEE QHLVEAAKLPVLLNLSFTYLKLDRPTIALCYGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQ KEQPFNHDINNELKKLASCYRDYVDKEKEMWHRMFAPCGDGSTAGES myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003593 |
RefSeq Size | 1640 |
RefSeq ORF | 981 |
Synonyms | FKBP36 |
Locus ID | 8468 |
Cytogenetics | 7q11.23 |
Summary | The protein encoded by this gene is a cis-trans peptidyl-prolyl isomerase that may function in immunoregulation and basic cellular processes involving protein folding and trafficking. This gene is located in a chromosomal region that is deleted in Williams-Beuren syndrome. Defects in this gene may cause male infertility. There are multiple pseudogenes for this gene located nearby on chromosome 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418553 | FKBP6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427592 | FKBP6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418553 | Transient overexpression lysate of FK506 binding protein 6, 36kDa (FKBP6), transcript variant 1 |
CNY 3,080.00 |
|
LY427592 | Transient overexpression lysate of FK506 binding protein 6, 36kDa (FKBP6), transcript variant 2 |
CNY 3,080.00 |
|
TP307712 | Recombinant protein of human FK506 binding protein 6, 36kDa (FKBP6), transcript variant 1, 20 µg |
CNY 2,900.00 |