United States
Germany
Japan
United Kingdom
China
P4HA2 (NM_001017973) Human Mass Spec Standard
CAT＃: PH307779
P4HA2 MS Standard C13 and N15-labeled recombinant protein (NP_001017973)
View other "P4HA2" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | P4HA2 MS Standard C13 and N15-labeled recombinant protein (NP_001017973) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207779 |
| Predicted MW | 60.6 kDa |
| Protein Sequence |
>RC207779 protein sequence
Red=Cloning site Green=Tags(s) MKLWVSALLMAWFGVLSCVQAEFFTSIGHMTDLIYAEKELVQSLKEYILVEEAKLSKIKSWANKMEALTS KSAADAEGYLAHPVNAYKLVKRLNTDWPALEDLVLQDSAAGFIANLSVQRQFFPTDEDEIGAAKALMRLQ DTYRLDPGTISRGELPGTKYQAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATTTKSQVL DYLSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRYFEQLLEEEREKTLTNQTEAELATPEGIYERP VDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDSPHIVRYYDVMSDEEI ERIKEIAKPKLARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVNRRMQHITGLTVKTAELLQVAN YGVGGQYEPHFDFSRRPFDSGLKTEGNRLATFLNYMSDVEAGGATVFPDLGAAIWPKKGTAVFWYNLLRS GEGDYRTRHAACPVLVGCKWVSNKWFHERGQEFLRPCGSTEVD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001017973 |
| RefSeq Size | 2582 |
| RefSeq ORF | 1599 |
| Synonyms | MYP25 |
| Locus ID | 8974 |
| Cytogenetics | 5q31.1 |
| Summary | This gene encodes a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part of the catalytic site of the active enzyme. In collagen and related proteins, prolyl 4-hydroxylase catalyzes the formation of 4-hydroxyproline that is essential to the proper three-dimensional folding of newly synthesized procollagen chains. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422630 | P4HA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422631 | P4HA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC428199 | P4HA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422630 | Transient overexpression lysate of prolyl 4-hydroxylase, alpha polypeptide II (P4HA2), transcript variant 2 |
CNY 3,080.00 |
|
| LY422631 | Transient overexpression lysate of prolyl 4-hydroxylase, alpha polypeptide II (P4HA2), transcript variant 3 |
CNY 4,840.00 |
|
| LY428199 | Transient overexpression lysate of prolyl 4-hydroxylase, alpha polypeptide II (P4HA2), transcript variant 4 |
CNY 3,080.00 |
|
| TP307779 | Recombinant protein of human prolyl 4-hydroxylase, alpha polypeptide II (P4HA2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP762642 | Purified recombinant protein of Human prolyl 4-hydroxylase, alpha polypeptide II (P4HA2), transcript variant 4 |
CNY 2,480.00 |
