CXCR2 (NM_001557) Human Mass Spec Standard
CAT#: PH307794
CXCR2 MS Standard C13 and N15-labeled recombinant protein (NP_001548)
View other "CXCR2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CXCR2 MS Standard C13 and N15-labeled recombinant protein (NP_001548) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207794 |
Predicted MW | 40.8 kDa |
Protein Sequence |
>RC207794 protein sequence
Red=Cloning site Green=Tags(s) MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFLLSLLGNSLVM LVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACI SVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPVLLFRRTVYSSNVSPACYEDMGNNTANWRML LRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQ VIQETCERRNHIDRALDATEILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVG SSSGHTSTTL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001548 |
RefSeq Size | 2880 |
RefSeq ORF | 1080 |
Synonyms | CD182; CDw128b; CMKAR2; IL8R2; IL8RA; IL8RB |
Locus ID | 3579 |
Cytogenetics | 2q35 |
Summary | The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. This receptor also binds to chemokine (C-X-C motif) ligand 1 (CXCL1/MGSA), a protein with melanoma growth stimulating activity, and has been shown to be a major component required for serum-dependent melanoma cell growth. This receptor mediates neutrophil migration to sites of inflammation. The angiogenic effects of IL8 in intestinal microvascular endothelial cells are found to be mediated by this receptor. Knockout studies in mice suggested that this receptor controls the positioning of oligodendrocyte precursors in developing spinal cord by arresting their migration. This gene, IL8RA, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36. Alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2009] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Endocytosis, Epithelial cell signaling in Helicobacter pylori infection |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400595 | CXCR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432936 | CXCR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400595 | Transient overexpression lysate of chemokine (C-X-C motif) receptor 2 (CXCR2), transcript variant 1 |
CNY 3,080.00 |
|
LY432936 | Transient overexpression lysate of chemokine (C-X-C motif) receptor 2 (CXCR2), transcript variant 2 |
CNY 3,080.00 |
|
TP307794 | Recombinant protein of human interleukin 8 receptor, beta (IL8RB), 20 µg |
CNY 2,900.00 |