SURF5 (MED22) (NM_181491) Human Mass Spec Standard
CAT#: PH308015
MED22 MS Standard C13 and N15-labeled recombinant protein (NP_852468)
View other "SURF5" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MED22 MS Standard C13 and N15-labeled recombinant protein (NP_852468) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208015 |
Predicted MW | 16.5 kDa |
Protein Sequence |
>RC208015 protein sequence
Red=Cloning site Green=Tags(s) MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVR AGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_852468 |
RefSeq Size | 3910 |
RefSeq ORF | 420 |
Synonyms | MED24; SRB6; surf-5; SURF5 |
Locus ID | 6837 |
Cytogenetics | 9q34.2 |
Summary | This gene encodes a protein component of the mediator complex, which functions in the regulation of transcription by bridging interactions between gene-specific regulatory factors, RNA polymerase II, and general transcription factors. Alternatively spliced transcript variants encoding different isoforms have been observed. [provided by RefSeq, Jul 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405682 | MED22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405682 | Transient overexpression lysate of mediator complex subunit 22 (MED22), transcript variant c |
CNY 3,080.00 |
|
TP308015 | Recombinant protein of human mediator complex subunit 22 (MED22), transcript variant c, 20 µg |
CNY 2,900.00 |