ARPC1A (NM_006409) Human Mass Spec Standard
CAT#: PH308053
ARPC1A MS Standard C13 and N15-labeled recombinant protein (NP_006400)
View other "ARPC1A" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ARPC1A MS Standard C13 and N15-labeled recombinant protein (NP_006400) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208053 |
Predicted MW | 41.6 kDa |
Protein Sequence |
>RC208053 protein sequence
Red=Cloning site Green=Tags(s) MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVKAHELKEHNGHITGIDWAPKSDRIVTC GADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKP IRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKPASTPWGSKMPFGQLMSEFGGSGTGGWVHGV SFSASGSRLAWVSHDSTVSVADASKSVQVSTLKTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCL TFVSKLDIPKQSIQRNMSAMERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDG AMTIWDFKTLESSIQGLRIM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006400 |
RefSeq Size | 1623 |
RefSeq ORF | 1110 |
Synonyms | Arc40; HEL-68; HEL-S-307; SOP2Hs; SOP2L |
Locus ID | 10552 |
Cytogenetics | 7q22.1 |
Summary | This gene encodes one of seven subunits of the human Arp2/3 protein complex. This subunit is a member of the SOP2 family of proteins and is most similar to the protein encoded by gene ARPC1B. The similarity between these two proteins suggests that they both may function as p41 subunit of the human Arp2/3 complex that has been implicated in the control of actin polymerization in cells. It is possible that the p41 subunit is involved in assembling and maintaining the structure of the Arp2/3 complex. Multiple versions of the p41 subunit may adapt the functions of the complex to different cell types or developmental stages. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010] |
Protein Pathways | Fc gamma R-mediated phagocytosis, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416669 | ARPC1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433813 | ARPC1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416669 | Transient overexpression lysate of actin related protein 2/3 complex, subunit 1A, 41kDa (ARPC1A) |
CNY 3,080.00 |
|
LY433813 | Transient overexpression lysate of actin related protein 2/3 complex, subunit 1A, 41kDa (ARPC1A), transcript variant 2 |
CNY 3,080.00 |
|
TP308053 | Recombinant protein of human actin related protein 2/3 complex, subunit 1A, 41kDa (ARPC1A), 20 µg |
CNY 2,900.00 |