RALA (NM_005402) Human Mass Spec Standard
CAT#: PH308076
RALA MS Standard C13 and N15-labeled recombinant protein (NP_005393)
View other "RALA" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RALA MS Standard C13 and N15-labeled recombinant protein (NP_005393) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208076 |
Predicted MW | 23.6 kDa |
Protein Sequence |
>RC208076 protein sequence
Red=Cloning site Green=Tags(s) MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVE EAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005393 |
RefSeq Size | 2828 |
RefSeq ORF | 618 |
Synonyms | HINCONS; RAL |
Locus ID | 5898 |
Cytogenetics | 7p14.1 |
Summary | The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Pancreatic cancer, Pathways in cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417324 | RALA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417324 | Transient overexpression lysate of v-ral simian leukemia viral oncogene homolog A (ras related) (RALA) |
CNY 3,080.00 |
|
TP308076 | Recombinant protein of human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), 20 µg |
CNY 2,900.00 |