United States
Germany
Japan
United Kingdom
China
ERG (NM_182918) Human Mass Spec Standard
CAT＃: PH308093
ERG MS Standard C13 and N15-labeled recombinant protein (NP_891548)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | ERG MS Standard C13 and N15-labeled recombinant protein (NP_891548) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208093 |
| Predicted MW | 53.7 kDa |
| Protein Sequence |
>RC208093 representing NM_182918
Red=Cloning site Green=Tags(s) MASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPARVTIKMEC NPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVR QWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDK ALQNSPRLMHARNTGGAAFIFPNTSVYPEATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTV PKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARR WGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGS YHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYY SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_891548 |
| RefSeq Size | 3055 |
| RefSeq ORF | 1437 |
| Synonyms | erg-3; p55 |
| Locus ID | 2078 |
| Cytogenetics | 21q22.2 |
| Summary | This gene encodes a member of the erythroblast transformation-specific (ETS) family of transcriptions factors. All members of this family are key regulators of embryonic development, cell proliferation, differentiation, angiogenesis, inflammation, and apoptosis. The protein encoded by this gene is mainly expressed in the nucleus. It contains an ETS DNA-binding domain and a PNT (pointed) domain which is implicated in the self-association of chimeric oncoproteins. This protein is required for platelet adhesion to the subendothelium, inducing vascular cell remodeling. It also regulates hematopoesis, and the differentiation and maturation of megakaryocytic cells. This gene is involved in chromosomal translocations, resulting in different fusion gene products, such as TMPSSR2-ERG and NDRG1-ERG in prostate cancer, EWS-ERG in Ewing's sarcoma and FUS-ERG in acute myeloid leukemia. More than two dozens of transcript variants generated from combinatorial usage of three alternative promoters and multiple alternative splicing events have been reported, but the full-length nature of many of these variants has not been determined. [provided by RefSeq, Apr 2014] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401413 | ERG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC403650 | ERG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427827 | ERG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401413 | Transient overexpression lysate of v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 2 |
CNY 4,840.00 |
|
| LY403650 | Transient overexpression lysate of v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 1 |
CNY 3,080.00 |
|
| LY427827 | Transient overexpression lysate of v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 3 |
CNY 3,080.00 |
|
| PH318892 | ERG MS Standard C13 and N15-labeled recombinant protein (NP_004440) |
CNY 19,520.00 |
|
| TP308093 | Recombinant protein of human v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP318892 | Recombinant protein of human v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 2, 20 µg |
CNY 2,900.00 |
