XRCC2 (NM_005431) Human Mass Spec Standard
CAT#: PH308330
XRCC2 MS Standard C13 and N15-labeled recombinant protein (NP_005422)
View other "XRCC2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | XRCC2 MS Standard C13 and N15-labeled recombinant protein (NP_005422) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208330 |
Predicted MW | 32 kDa |
Protein Sequence |
>RC208330 protein sequence
Red=Cloning site Green=Tags(s) MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKS EGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYCLGRFFLVYCSSSTHLLLTLYSLESMFCSH PSLCLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFATTQTIMQKASSSSEEPS HASRRLCDVDIDYRPYLCKAWQQLVKHRMFFSKQDDSQSSNQFSLVSRCLKSNSLKKHFFIIGESGVEFC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005422 |
RefSeq Size | 3094 |
RefSeq ORF | 840 |
Synonyms | FANCU; POF17; SPGF50 |
Locus ID | 7516 |
Cytogenetics | 7q36.1 |
Summary | This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Homologous recombination |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417301 | XRCC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417301 | Transient overexpression lysate of X-ray repair complementing defective repair in Chinese hamster cells 2 (XRCC2) |
CNY 3,080.00 |
|
TP308330 | Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 2 (XRCC2), 20 µg |
CNY 2,900.00 |