United States
Germany
Japan
United Kingdom
China
APOL3 (NM_145639) Human Mass Spec Standard
CAT＃: PH308643
APOL3 MS Standard C13 and N15-labeled recombinant protein (NP_663614)
View other "APOL3" proteins (16)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | APOL3 MS Standard C13 and N15-labeled recombinant protein (NP_663614) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208643 |
| Predicted MW | 36.5 kDa |
| Protein Sequence |
>RC208643 protein sequence
Red=Cloning site Green=Tags(s) MDSEKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEADALYEALKKLRTYAAIEDEYV QQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGCTISNVVSSSTGAASGIMSLAGLVLAPF TAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLL NNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLAL DVVNLVYESKHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_663614 |
| RefSeq Size | 2215 |
| RefSeq ORF | 993 |
| Synonyms | apoL-III; APOLIII; CG12_1; CG121 |
| Locus ID | 80833 |
| Cytogenetics | 22q12.3 |
| Summary | This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 22. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403433 | APOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407916 | APOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407939 | APOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407940 | APOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410766 | APOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415350 | APOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429418 | APOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403433 | Transient overexpression lysate of apolipoprotein L, 3 (APOL3), transcript variant beta/a |
CNY 3,080.00 |
|
| LY407916 | Transient overexpression lysate of apolipoprotein L, 3 (APOL3), transcript variant beta/b |
CNY 3,080.00 |
|
| LY407939 | Transient overexpression lysate of apolipoprotein L, 3 (APOL3), transcript variant alpha/c |
CNY 3,080.00 |
|
| LY407940 | Transient overexpression lysate of apolipoprotein L, 3 (APOL3), transcript variant alpha/d |
CNY 3,080.00 |
|
| LY410766 | Transient overexpression lysate of apolipoprotein L, 3 (APOL3), transcript variant alpha/b |
CNY 3,080.00 |
|
| LY415350 | Transient overexpression lysate of apolipoprotein L, 3 (APOL3), transcript variant alpha/a |
CNY 3,080.00 |
|
| TP308643 | Recombinant protein of human apolipoprotein L, 3 (APOL3), transcript variant alpha/c, 20 µg |
CNY 2,900.00 |
|
| TP761559 | Purified recombinant protein of Human apolipoprotein L, 3 (APOL3), transcript variant beta/a, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
|
| TP762662 | Purified recombinant protein of Human apolipoprotein L, 3 (APOL3), transcript variant beta/b |
CNY 2,480.00 |
