SMAD3 (NM_005902) Human Mass Spec Standard
CAT#: PH308749
SMAD3 MS Standard C13 and N15-labeled recombinant protein (NP_005893)
View other "SMAD3" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SMAD3 MS Standard C13 and N15-labeled recombinant protein (NP_005893) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208749 |
Predicted MW | 47.9 kDa |
Protein Sequence |
>RC208749 representing NM_005902
Red=Cloning site Green=Tags(s) MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRS LDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLV PRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPN PMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRN AAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAA LLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR CSSVS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005893 |
RefSeq Size | 6256 |
RefSeq ORF | 1275 |
Synonyms | HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3 |
Locus ID | 4088 |
Cytogenetics | 15q22.33 |
Summary | The SMAD family of proteins are a group of intracellular signal transducer proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. The SMAD3 protein functions in the transforming growth factor-beta signaling pathway, and transmits signals from the cell surface to the nucleus, regulating gene activity and cell proliferation. It also functions as a tumor suppressor. Mutations in this gene are associated with aneurysms-osteoarthritis syndrome and Loeys-Dietz Syndrome 3. [provided by RefSeq, Nov 2019] |
Protein Families | Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Stem cell relevant signaling - JAK/STAT signaling pathway, Stem cell relevant signaling - TGFb/BMP signaling pathway, Transcription Factors |
Protein Pathways | Adherens junction, Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Pancreatic cancer, Pathways in cancer, TGF-beta signaling pathway, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401784 | SMAD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428691 | SMAD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401784 | Transient overexpression lysate of SMAD family member 3 (SMAD3), transcript variant 1 |
CNY 3,080.00 |
|
LY428691 | Transient overexpression lysate of SMAD family member 3 (SMAD3), transcript variant 3 |
CNY 3,080.00 |
|
TP308749 | Recombinant protein of human SMAD family member 3 (SMAD3), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP762386 | Purified recombinant protein of Human SMAD family member 3 (SMAD3), transcript variant 1, Ser2-Ala230, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |