United States
Germany
Japan
United Kingdom
China
LAP2 (TMPO) (NM_001032283) Human Mass Spec Standard
CAT＃: PH308781
TMPO MS Standard C13 and N15-labeled recombinant protein (NP_001027454)
View other "LAP2" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | TMPO MS Standard C13 and N15-labeled recombinant protein (NP_001027454) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208781 |
| Predicted MW | 50.7 kDa |
| Protein Sequence |
>RC208781 protein sequence
Red=Cloning site Green=Tags(s) MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEE REPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRK LYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNEEDSKIELKLEKREPLKGRAKTPV TLKQRRVEHNQSYSQAGITETEWTSGSSKGGPLQALTRESTRGSRRTPRKRVETSEHFRIDGPVISESTP IAETIMASSNESLVVNRVTGNFKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDILKEMFP YEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGRSIPVWIKILLF VVVAVFLFLVYQAMETNQVNPFSNFLHVDPRKSN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001027454 |
| RefSeq Size | 4186 |
| RefSeq ORF | 1362 |
| Synonyms | CMD1T; LAP2; LEMD4; PRO0868; TP |
| Locus ID | 7112 |
| Cytogenetics | 12q23.1 |
| Summary | Through alternative splicing, this gene encodes several distinct LEM domain containing protein isoforms. LEM domain proteins include inner nuclear membrane and intranuclear proteins, and are involved in a variety of cellular functions including gene expression, chromatin organization, and replication and cell cycle control. The encoded alpha isoform is broadly diffuse in the nucleus and contains a lamin binding domain, while the beta and gamma isoforms are localized to the nuclear membrane and contain an HDAC3 interaction domain. The distinct isoforms may compete with each other when acting to chaperone other proteins and regulate transcription. [provided by RefSeq, Aug 2019] |
| Protein Families | Stem cell - Pluripotency, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418798 | TMPO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC422295 | TMPO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422296 | TMPO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418798 | Transient overexpression lysate of thymopoietin (TMPO), transcript variant 1 |
CNY 4,840.00 |
|
| LY422295 | Transient overexpression lysate of thymopoietin (TMPO), transcript variant 2 |
CNY 3,080.00 |
|
| LY422296 | Transient overexpression lysate of thymopoietin (TMPO), transcript variant 3 |
CNY 3,080.00 |
|
| TP308781 | Recombinant protein of human thymopoietin (TMPO), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP720158 | Recombinant protein of human thymopoietin (TMPO), transcript variant 2 |
CNY 3,140.00 |
|
| TP761176 | Purified recombinant protein of Human thymopoietin (TMPO), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
