GRAP (NM_006613) Human Mass Spec Standard
CAT#: PH308908
GRAP MS Standard C13 and N15-labeled recombinant protein (NP_006604)
View other "GRAP" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GRAP MS Standard C13 and N15-labeled recombinant protein (NP_006604) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208908 |
Predicted MW | 25.3 kDa |
Protein Sequence |
>RC208908 protein sequence
Red=Cloning site Green=Tags(s) MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHPWYSGRISRQLA EEILMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFLWEEKFNSLNELVDFYRTTTI AKKRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPDPHWWRGRSCGRVGFFPRS YVQPVHL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006604 |
RefSeq Size | 2089 |
RefSeq ORF | 651 |
Synonyms | DFNB114 |
Locus ID | 10750 |
Cytogenetics | 17p11.2 |
Summary | This gene encodes a member of the GRB2/Sem5/Drk family and functions as a cytoplasmic signaling protein which contains an SH2 domain flanked by two SH3 domains. The SH2 domain interacts with ligand-activated receptors for stem cell factor and erythropoietin, and facilitates the formation of a stable complex with the BCR-ABL oncoprotein. This protein also associates with the Ras guanine nucleotide exchange factor SOS1 (son of sevenless homolog 1) through its N-terminal SH3 domain. In general, it couples signals from receptor and cytoplasmic tyrosine kinases to the Ras signaling pathway. [provided by RefSeq, Jul 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416529 | GRAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416529 | Transient overexpression lysate of GRB2-related adaptor protein (GRAP) |
CNY 3,080.00 |
|
TP308908 | Recombinant protein of human GRB2-related adaptor protein (GRAP), 20 µg |
CNY 2,900.00 |