ICOS Ligand (ICOSLG) (NM_015259) Human Mass Spec Standard
CAT#: PH308975
ICOSLG MS Standard C13 and N15-labeled recombinant protein (NP_056074)
View other "ICOS Ligand" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | ICOSLG MS Standard C13 and N15-labeled recombinant protein (NP_056074) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208975 |
Predicted MW | 33.3 kDa |
Protein Sequence |
>RC208975 protein sequence
Red=Cloning site Green=Tags(s) MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQN SSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSV PVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPS VNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDR CLQHSYAGAWAVSPETELTGHV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056074 |
RefSeq Size | 3320 |
RefSeq ORF | 906 |
Synonyms | B7-H2; B7h; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS |
Locus ID | 23308 |
Cytogenetics | 21q22.3 |
Summary | Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion; induces also B-cell proliferation and differentiation into plasma cells. Could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402420 | ICOSLG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402420 | Transient overexpression lysate of inducible T-cell co-stimulator ligand (ICOSLG) |
CNY 3,080.00 |
|
TP308975 | Recombinant protein of human inducible T-cell co-stimulator ligand (ICOSLG), 20 µg |
CNY 2,900.00 |
|
TP700281 | Purified recombinant protein of human inducible T-cell co-stimulator ligand (ICOSLG), with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP720398 | Recombinant protein of human inducible T-cell co-stimulator ligand (ICOSLG) |
CNY 1,800.00 |
|
TP723952 | Human B7-H2 Protein, mFc-His Tag |
CNY 4,925.00 |
其它ICOS Ligand产品