KREMEN1 (NM_001039571) Human Mass Spec Standard
CAT#: PH308991
KREMEN1 MS Standard C13 and N15-labeled recombinant protein (NP_001034660)
View other "KREMEN1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | KREMEN1 MS Standard C13 and N15-labeled recombinant protein (NP_001034660) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208991 |
Predicted MW | 50.18 kDa |
Protein Sequence |
>RC208991 representing NM_001039571
Red=Cloning site Green=Tags(s) MAPPAARLALLSAAALTLAARPAPSPGLGPGPECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNT LKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKT SNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFD TLVGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRV LARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSV SAARSSKVLYVITTSPSHPPQTVPGWTVYGLATLLILTVTAIVAKILLHVTFKSHRVPASGDLRDCHQPG TSGEIWSIFYKPSTSISIFKKKLKGQSQQDDRNPLVSD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001034660 |
RefSeq Size | 6115 |
RefSeq ORF | 1374 |
Synonyms | FLJ31863; KREMEM1; KREMEN; kringle-coding gene marking the eye and the nose; kringle-containing transmembrane protein 1; kringle containing transmembrane protein 1; KRM1; OTTHUMP00000028977 |
Locus ID | 83999 |
Cytogenetics | 22q12.1 |
Summary | This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422073 | KREMEN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC422074 | KREMEN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429793 | KREMEN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422073 | Transient overexpression lysate of kringle containing transmembrane protein 1 (KREMEN1), transcript variant 3 |
CNY 4,840.00 |
|
LY422074 | Transient overexpression lysate of kringle containing transmembrane protein 1 (KREMEN1), transcript variant 4 |
CNY 3,080.00 |
|
LY429793 | Transient overexpression lysate of kringle containing transmembrane protein 1 (KREMEN1), transcript variant 2 |
CNY 3,080.00 |
|
TP308991 | Recombinant protein of human kringle containing transmembrane protein 1 (KREMEN1), transcript variant 4, 20 µg |
CNY 2,900.00 |
其它KREMEN1产品