SUOX (NM_000456) Human Mass Spec Standard
CAT#: PH309066
SUOX MS Standard C13 and N15-labeled recombinant protein (NP_000447)
View other "SUOX" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SUOX MS Standard C13 and N15-labeled recombinant protein (NP_000447) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209066 |
Predicted MW | 60.3 kDa |
Protein Sequence |
>RC209066 protein sequence
Red=Cloning site Green=Tags(s) MLLLHRAVVLRLQQACRLKSIPSRICIQACSTNDSFQPQRPSLTFSGDNSSTQGWRVMGTLLGLGAVLAY QDHRCRAAQESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALY AVHNQSHVRELLAQYKIGELNPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITP NPIFFTRNHLPVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKG LEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAY EMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSI QELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRL WQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYVSP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000447 |
RefSeq Size | 2564 |
RefSeq ORF | 1635 |
Locus ID | 6821 |
Cytogenetics | 12q13.2 |
Summary | Sulfite oxidase is a homodimeric protein localized to the intermembrane space of mitochondria. Each subunit contains a heme domain and a molybdopterin-binding domain. The enzyme catalyzes the oxidation of sulfite to sulfate, the final reaction in the oxidative degradation of the sulfur amino acids cysteine and methionine. Sulfite oxidase deficiency results in neurological abnormalities which are often fatal at an early age. Alternative splicing results in multiple transcript variants encoding identical proteins. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Sulfur metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422321 | SUOX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC422322 | SUOX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC424706 | SUOX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425535 | SUOX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422321 | Transient overexpression lysate of sulfite oxidase (SUOX), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 4,840.00 |
|
LY422322 | Transient overexpression lysate of sulfite oxidase (SUOX), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 4,840.00 |
|
LY424706 | Transient overexpression lysate of sulfite oxidase (SUOX), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
TP309066 | Recombinant protein of human sulfite oxidase (SUOX), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2,900.00 |