Cystatin SA (CST2) (NM_001322) Human Mass Spec Standard
CAT#: PH309350
CST2 MS Standard C13 and N15-labeled recombinant protein (NP_001313)
View other "Cystatin SA" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CST2 MS Standard C13 and N15-labeled recombinant protein (NP_001313) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209350 |
Predicted MW | 16.4 kDa |
Protein Sequence |
>RC209350 protein sequence
Red=Cloning site Green=Tags(s) MAWPLCTLLLLLATQAVALAWSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATEDEYYRRLLRV LRAREQIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFQIYEVPWEDRMSLVNSRCQE A myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001313 |
RefSeq Size | 694 |
RefSeq ORF | 423 |
Locus ID | 1470 |
Cytogenetics | 20p11.21 |
Summary | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a secreted thiol protease inhibitor found at high levels in saliva, tears and seminal plasma. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420010 | CST2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420010 | Transient overexpression lysate of cystatin SA (CST2) |
CNY 3,080.00 |
|
TP309350 | Recombinant protein of human cystatin SA (CST2), 20 µg |
CNY 2,900.00 |
|
TP720294 | Recombinant protein of human cystatin SA (CST2) |
CNY 3,140.00 |
其它Cystatin SA产品