Dermcidin (DCD) (NM_053283) Human Mass Spec Standard
CAT#: PH309352
DCD MS Standard C13 and N15-labeled recombinant protein (NP_444513)
View other "Dermcidin" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | DCD MS Standard C13 and N15-labeled recombinant protein (NP_444513) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209352 |
Predicted MW | 11.3 kDa |
Protein Sequence |
>RC209352 protein sequence
Red=Cloning site Green=Tags(s) MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGL DGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_444513 |
RefSeq Size | 645 |
RefSeq ORF | 330 |
Synonyms | AIDD; DCD-1; DSEP; HCAP; PIF |
Locus ID | 117159 |
Cytogenetics | 12q13.2 |
Summary | This antimicrobial gene encodes a secreted protein that is subsequently processed into mature peptides of distinct biological activities. The C-terminal peptide is constitutively expressed in sweat and has antibacterial and antifungal activities. The N-terminal peptide, also known as diffusible survival evasion peptide, promotes neural cell survival under conditions of severe oxidative stress. A glycosylated form of the N-terminal peptide may be associated with cachexia (muscle wasting) in cancer patients. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403291 | DCD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403291 | Transient overexpression lysate of dermcidin (DCD) |
CNY 3,080.00 |
|
TP309352 | Recombinant protein of human dermcidin (DCD), 20 µg |
CNY 2,900.00 |
|
TP701063 | Purified recombinant protein of Human dermcidin (DCD), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7,106.00 |
其它Dermcidin产品