REEP1 (NM_022912) Human Mass Spec Standard
CAT#: PH309615
REEP1 MS Standard C13 and N15-labeled recombinant protein (NP_075063)
View other "REEP1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | REEP1 MS Standard C13 and N15-labeled recombinant protein (NP_075063) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209615 |
Predicted MW | 22.3 kDa |
Protein Sequence |
>RC209615 protein sequence
Red=Cloning site Green=Tags(s) MVSWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLCWFPFYYELKI AFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKG QGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGTA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_075063 |
RefSeq Size | 3868 |
RefSeq ORF | 603 |
Synonyms | C2orf23; HMN5B; SPG31; Yip2a |
Locus ID | 65055 |
Cytogenetics | 2p11.2 |
Summary | This gene encodes a mitochondrial protein that functions to enhance the cell surface expression of odorant receptors. Mutations in this gene cause spastic paraplegia autosomal dominant type 31, a neurodegenerative disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411461 | REEP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431110 | REEP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411461 | Transient overexpression lysate of receptor accessory protein 1 (REEP1), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3,080.00 |
|
LY431110 | Transient overexpression lysate of receptor accessory protein 1 (REEP1), nuclear gene encoding mitochondrial protein, transcript variant 4 |
CNY 3,080.00 |
|
TP309615 | Recombinant protein of human receptor accessory protein 1 (REEP1), 20 µg |
CNY 2,900.00 |