Ferritin Heavy Chain (FTH1) (NM_002032) Human Mass Spec Standard
CAT#: PH309845
FTH1 MS Standard C13 and N15-labeled recombinant protein (NP_002023)
View other "Ferritin Heavy Chain" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FTH1 MS Standard C13 and N15-labeled recombinant protein (NP_002023) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209845 |
Predicted MW | 21.2 kDa |
Protein Sequence |
>RC209845 protein sequence
Red=Cloning site Green=Tags(s) MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKL MKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLN EQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002023 |
RefSeq Size | 1245 |
RefSeq ORF | 549 |
Synonyms | FHC; FTH; FTHL6; HFE5; PIG15; PLIF |
Locus ID | 2495 |
Cytogenetics | 11q12.3 |
Summary | This gene encodes the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene has multiple pseudogenes. Several alternatively spliced transcript variants have been observed, but their biological validity has not been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Porphyrin and chlorophyll metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400741 | FTH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400741 | Transient overexpression lysate of ferritin, heavy polypeptide 1 (FTH1) |
CNY 3,080.00 |
|
TP309845 | Recombinant protein of human ferritin, heavy polypeptide 1 (FTH1), 20 µg |
CNY 2,900.00 |
|
TP721180 | Purified recombinant protein of Human ferritin, heavy polypeptide 1 (FTH1) |
CNY 3,140.00 |
|
TP721183 | Purified recombinant protein of Human ferritin, heavy polypeptide 1 (FTH1) |
CNY 3,140.00 |
其它Ferritin Heavy Chain产品