p53R2 (RRM2B) (NM_015713) Human Mass Spec Standard
CAT#: PH310340
RRM2B MS Standard C13 and N15-labeled recombinant protein (NP_056528)
View other "p53R2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | RRM2B MS Standard C13 and N15-labeled recombinant protein (NP_056528) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210340 |
Predicted MW | 40.7 kDa |
Protein Sequence |
>RC210340 protein sequence
Red=Cloning site Green=Tags(s) MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVD LSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSL LIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKK RGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCI LMKQYIEFVADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDAD F myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056528 |
RefSeq Size | 4932 |
RefSeq ORF | 1053 |
Synonyms | MTDPS8A; MTDPS8B; P53R2 |
Locus ID | 50484 |
Cytogenetics | 8q22.3 |
Summary | This gene encodes the small subunit of a p53-inducible ribonucleotide reductase. This heterotetrameric enzyme catalyzes the conversion of ribonucleoside diphosphates to deoxyribonucleoside diphosphates. The product of this reaction is necessary for DNA synthesis. Mutations in this gene have been associated with autosomal recessive mitochondrial DNA depletion syndrome, autosomal dominant progressive external ophthalmoplegia-5, and mitochondrial neurogastrointestinal encephalopathy. Alternatively spliced transcript variants have been described.[provided by RefSeq, Feb 2010] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Glutathione metabolism, Metabolic pathways, p53 signaling pathway, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414401 | RRM2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433055 | RRM2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414401 | Transient overexpression lysate of ribonucleotide reductase M2 B (TP53 inducible) (RRM2B) |
CNY 3,080.00 |
|
LY433055 | Transient overexpression lysate of ribonucleotide reductase M2 B (TP53 inducible) (RRM2B), transcript variant 2 |
CNY 3,080.00 |
|
TP310340 | Recombinant protein of human ribonucleotide reductase M2 B (TP53 inducible) (RRM2B), 20 µg |
CNY 2,900.00 |