PRPH2 (NM_000322) Human Mass Spec Standard
CAT#: PH310357
PRPH2 MS Standard C13 and N15-labeled recombinant protein (NP_000313)
View other "PRPH2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | PRPH2 MS Standard C13 and N15-labeled recombinant protein (NP_000313) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210357 |
Predicted MW | 39.1 kDa |
Protein Sequence |
>RC210357 protein sequence
Red=Cloning site Green=Tags(s) MALLKVKFDQKKRVKLAQGLWLMNWFSVLAGIIIFSLGLFLKIGLRKRSDVMNNSESHFVPNSLIGMGVL SCVFNSLAGKICYDALDPAKYARWKPWLKPYLAICVLFNIILFLVALCCFLLRGSLENTLGQGLKNGMKY YRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFRDWFEIQWISNRYLDFSSKEVKDRIKSNVDGRYLVDGVP FSCCNPSSPRPCIQYQITNNSAHYSYDHQTEELNLWVRGCRAALLSYYSSLMNSMGVVTLLIWLFEVTIT IGLRYLQTSLDGVSNPEESESESEGWLLEKSVPETWKAFLESVKKLGKGNQVEAEGAGAGQAPEAG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000313 |
RefSeq Size | 3027 |
RefSeq ORF | 1038 |
Synonyms | AOFMD; AVMD; CACD2; DS; MDBS1; PRPH; rd2; RDS; RP7; TSPAN22 |
Locus ID | 5961 |
Cytogenetics | 6p21.1 |
Summary | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein found in the outer segment of both rod and cone photoreceptor cells. It may function as an adhesion molecule involved in stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. This protein is essential for disk morphogenesis. Defects in this gene are associated with both central and peripheral retinal degenerations. Some of the various phenotypically different disorders are autosomal dominant retinitis pigmentosa, progressive macular degeneration, macular dystrophy and retinitis pigmentosa digenic. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Amyotrophic lateral sclerosis (ALS) |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400122 | PRPH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400122 | Transient overexpression lysate of peripherin 2 (retinal degeneration, slow) (PRPH2) |
CNY 3,080.00 |
|
TP310357 | Recombinant protein of human peripherin 2 (retinal degeneration, slow) (PRPH2), 20 µg |
CNY 2,900.00 |