ACCN1 (ASIC2) (NM_001094) Human Mass Spec Standard
CAT#: PH310409
ACCN1 MS Standard C13 and N15-labeled recombinant protein (NP_001085)
View other "ACCN1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ACCN1 MS Standard C13 and N15-labeled recombinant protein (NP_001085) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210409 |
Predicted MW | 57.7 kDa |
Protein Sequence |
>RC210409 protein sequence
Red=Cloning site Green=Tags(s) MDLKESPSEGSLQPSSIQIFANTSTLHGIRHIFVYGPLTIRRVLWAVAFVGSLGLLLVESSERVSYYFSY QHVTKVDEVVAQSLVFPAVTLCNLNGFRFSRLTTNDLYHAGELLALLDVNLQIPDPHLADPSVLEALRQK ANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGHQDFTTVFTKYGKCYMFNSGEDGKPLLTTVK GGTGNGLEIMLDIQQDEYLPIWGETEETTFEAGVKVQIHSQSEPPFIQELGFGVAPGFQTFVATQEQRLT YLPPPWGECRSSEMGLDFFPVYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLL AEKDSNYCLCRTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQK KAYEVAALLGDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENVSTCDTMPNHSE TISHTVNVPLQTTLGTLEEIAC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001085 |
RefSeq Size | 2747 |
RefSeq ORF | 1536 |
Synonyms | ACCN; ACCN1; ASIC2a; BNaC1; BNC1; hBNaC1; MDEG |
Locus ID | 40 |
Cytogenetics | 17q11.2-q12 |
Summary | This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified. [provided by RefSeq, Feb 2012] |
Protein Families | Druggable Genome, Ion Channels: Other |
Protein Pathways | Taste transduction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400449 | ASIC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405257 | ASIC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400449 | Transient overexpression lysate of amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 2 |
CNY 3,080.00 |
|
LY405257 | Transient overexpression lysate of amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 1 |
CNY 4,840.00 |
|
TP310409 | Recombinant protein of human amiloride-sensitive cation channel 1, neuronal (ACCN1), transcript variant 2, 20 µg |
CNY 2,900.00 |