Macrophage Inflammatory Protein 1 beta (CCL4) (NM_002984) Human Mass Spec Standard
CAT#: PH310481
CCL4 MS Standard C13 and N15-labeled recombinant protein (NP_002975)
View other "Macrophage Inflammatory Protein 1 beta" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CCL4 MS Standard C13 and N15-labeled recombinant protein (NP_002975) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210481 |
Predicted MW | 10.2 kDa |
Protein Sequence |
>RC210481 protein sequence
Red=Cloning site Green=Tags(s) MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRS KQVCADPSESWVQEYVYDLELN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002975 |
RefSeq Size | 667 |
RefSeq ORF | 276 |
Synonyms | ACT2; AT744.1; G-26; HC21; LAG-1; LAG1; MIP-1-beta; MIP1B; MIP1B1; SCYA2; SCYA4 |
Locus ID | 6351 |
Cytogenetics | 17q12 |
Summary | The protein encoded by this gene is a mitogen-inducible monokine and is one of the major HIV-suppressive factors produced by CD8+ T-cells. The encoded protein is secreted and has chemokinetic and inflammatory functions. [provided by RefSeq, Dec 2012] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401043 | CCL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401043 | Transient overexpression lysate of chemokine (C-C motif) ligand 4 (CCL4), transcript variant 1 |
CNY 3,080.00 |
|
TP310481 | Recombinant protein of human chemokine (C-C motif) ligand 4 (CCL4), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Macrophage Inflammatory Protein 1 beta产品