NDUFA4 (NM_002489) Human Mass Spec Standard
CAT#: PH310482
NDUFA4 MS Standard C13 and N15-labeled recombinant protein (NP_002480)
View other "NDUFA4" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | NDUFA4 MS Standard C13 and N15-labeled recombinant protein (NP_002480) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210482 |
Predicted MW | 9.4 kDa |
Protein Sequence |
>RC210482 protein sequence
Red=Cloning site Green=Tags(s) MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVD YSKLKKERPDF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002480 |
RefSeq Size | 2058 |
RefSeq ORF | 243 |
Synonyms | CI-9k; CI-MLRQ; COXFA4; MC4DN21; MISTR1; MLRQ; MRCAF1 |
Locus ID | 4697 |
Cytogenetics | 7p21.3 |
Summary | The protein encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400888 | NDUFA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400888 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa (NDUFA4), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP310482 | Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa (NDUFA4), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |