RAB21 (NM_014999) Human Mass Spec Standard
CAT#: PH310510
RAB21 MS Standard C13 and N15-labeled recombinant protein (NP_055814)
View other "RAB21" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | RAB21 MS Standard C13 and N15-labeled recombinant protein (NP_055814) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210510 |
Predicted MW | 24.3 kDa |
Protein Sequence |
>RC210510 protein sequence
Red=Cloning site Green=Tags(s) MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNL AIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKER HVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDD EPQAQTSGGGCCSSG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055814 |
RefSeq Size | 2627 |
RefSeq ORF | 675 |
Locus ID | 23011 |
Cytogenetics | 12q21.1 |
Summary | This gene belongs to the Rab family of monomeric GTPases, which are involved in the control of cellular membrane traffic. The encoded protein plays a role in the targeted trafficking of integrins via its association with integrin alpha tails. As a consequence, the encoded protein is involved in the regulation of cell adhesion and migration. Expression of this gene is associated with a poor prognosis for glioma patients. This gene is downregulated by the tumor suppressor miR-200b, and miRNA-200b is itself downregulated in glioma tissues. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402398 | RAB21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402398 | Transient overexpression lysate of RAB21, member RAS oncogene family (RAB21) |
CNY 3,080.00 |
|
TP310510 | Recombinant protein of human RAB21, member RAS oncogene family (RAB21), 20 µg |
CNY 2,900.00 |