Acid Phosphatase 2 (ACP2) (NM_001610) Human Mass Spec Standard
CAT#: PH310562
ACP2 MS Standard C13 and N15-labeled recombinant protein (NP_001601)
View other "Acid Phosphatase 2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | ACP2 MS Standard C13 and N15-labeled recombinant protein (NP_001601) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210562 |
Predicted MW | 44.45 kDa |
Protein Sequence |
>RC210562 representing NM_001610
Red=Cloning site Green=Tags(s) MAGKRXXGWSRAALLQLLLGVNLVVMPPTRARSLRFVTLLYRHGDRSPVKTYPKDPYQEEEWPQGFGQLT KEGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNGMQRFNPNISWQPI PVHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANETGLTDLTLETVWNVYDT LFCEQTHGLRLPPWASPQTMQRLSRLKDFSFRFLFGIYQQAEKARLQGGVLLAQIRKNLTLMATTSQLPK LLVYSAHDTTLVALQMALDVYNGEQAPYASCHIFELYQEDSGNFSVEMYFRNESDKAPWPLSLPGCPHRC PLQDFLRLTEPVVPKDWQQECQLASGPADTEVIVALAVCGSILFLLIVLLLTVLFRMQAQPPGYRHVADG EDHA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001601 |
RefSeq Size | 2218 |
RefSeq ORF | 1270 |
Synonyms | LAP |
Locus ID | 53 |
Cytogenetics | 11p11.2|11p12-p11 |
Summary | The protein encoded by this gene belongs to the histidine acid phosphatase family, which hydrolyze orthophosphoric monoesters to alcohol and phosphate. This protein is localized to the lysosomal membrane, and is chemically and genetically distinct from the red cell acid phosphatase. Mice lacking this gene showed multiple defects, including bone structure alterations, lysosomal storage defects, and an increased tendency towards seizures. An enzymatically-inactive allele of this gene in mice showed severe growth retardation, hair-follicle abnormalities, and an ataxia-like phenotype. Alternatively spliced transcript variants have been found for this gene. A C-terminally extended isoform is also predicted to be produced by the use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism. [provided by RefSeq, Oct 2017] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Lysosome, Riboflavin metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC427374 | ACP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY427374 | Transient overexpression lysate of acid phosphatase 2, lysosomal (ACP2), transcript variant 2 |
CNY 3,080.00 |
|
TP310562 | Purified recombinant protein of Homo sapiens acid phosphatase 2, lysosomal (ACP2), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Acid Phosphatase 2产品