MACROH2A1 (NM_004893) Human Mass Spec Standard
CAT#: PH310576
H2AFY MS Standard C13 and N15-labeled recombinant protein (NP_004884)
View other "MACROH2A1" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | H2AFY MS Standard C13 and N15-labeled recombinant protein (NP_004884) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210576 |
Predicted MW | 39.5 kDa |
Protein Sequence |
>RC210576 protein sequence
Red=Cloning site Green=Tags(s) MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARD NKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKGKLEAIITPPPAKKAKSPS QKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKLNLIHSEISNLAGF EVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPV WGADKCEELLGKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVY FVLFDSESIGIYVQEMAKLDAN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004884 |
RefSeq Size | 1923 |
RefSeq ORF | 1116 |
Synonyms | H2A.y; H2A/y; H2AF12M; H2AFY; MACROH2A1.1; macroH2A1.2; mH2A1 |
Locus ID | 9555 |
Cytogenetics | 5q31.1 |
Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2015] |
Protein Pathways | Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417679 | H2AFY HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421700 | H2AFY HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417679 | Transient overexpression lysate of H2A histone family, member Y (H2AFY), transcript variant 2 |
CNY 3,080.00 |
|
LY421700 | Transient overexpression lysate of H2A histone family, member Y (H2AFY), transcript variant 4 |
CNY 3,080.00 |
|
TP310576 | Recombinant protein of human H2A histone family, member Y (H2AFY), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP761258 | Purified recombinant protein of Human H2A histone family, member Y (H2AFY), transcript variant 4, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它MACROH2A1产品