SAR1B (NM_016103) Human Mass Spec Standard
CAT#: PH310593
SAR1B MS Standard C13 and N15-labeled recombinant protein (NP_057187)
View other "SAR1B" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SAR1B MS Standard C13 and N15-labeled recombinant protein (NP_057187) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210593 |
Predicted MW | 22.4 kDa |
Protein Sequence |
>RC210593 protein sequence
Red=Cloning site Green=Tags(s) MSFIFDWIYSGFSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT FTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVPILILGNKIDRPE AISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSVLKRQGYGEGFRWMAQYID myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057187 |
RefSeq Size | 6532 |
RefSeq ORF | 594 |
Synonyms | ANDD; CMRD; GTBPB; SARA2 |
Locus ID | 51128 |
Cytogenetics | 5q31.1 |
Summary | The protein encoded by this gene is a small GTPase that acts as a homodimer. The encoded protein is activated by the guanine nucleotide exchange factor PREB and is involved in protein transport from the endoplasmic reticulum to the Golgi. This protein is part of the COPII coat complex. Defects in this gene are a cause of chylomicron retention disease (CMRD), also known as Anderson disease (ANDD). Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Mar 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402500 | SAR1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422370 | SAR1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402500 | Transient overexpression lysate of SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 2 |
CNY 3,080.00 |
|
LY422370 | Transient overexpression lysate of SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 1 |
CNY 3,080.00 |
|
PH313692 | SAR1B MS Standard C13 and N15-labeled recombinant protein (NP_001028675) |
CNY 19,520.00 |
|
TP310593 | Recombinant protein of human SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP313692 | Recombinant protein of human SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 1, 20 µg |
CNY 2,900.00 |