ABHD2 (NM_152924) Human Mass Spec Standard
CAT#: PH310637
ABHD2 MS Standard C13 and N15-labeled recombinant protein (NP_690888)
View other "ABHD2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ABHD2 MS Standard C13 and N15-labeled recombinant protein (NP_690888) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210637 |
Predicted MW | 48.3 kDa |
Protein Sequence |
>RC210637 protein sequence
Red=Cloning site Green=Tags(s) MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCPLLTKEYIPPL IWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEK QYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQLVVVGFSLGG NIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHV KKPQSLEDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHE SLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKLQCSDTEQV EADLE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_690888 |
RefSeq Size | 8761 |
RefSeq ORF | 1275 |
Synonyms | HS1-2; LABH2; PHPS1-2 |
Locus ID | 11057 |
Cytogenetics | 15q26.1 |
Summary | This gene encodes a protein containing an alpha/beta hydrolase fold, which is a catalytic domain found in a wide range of enzymes. The encoded protein is an acylglycerol lipase that catalyzes the hydrolysis of endocannabinoid arachidonoylglycerol from the cell membrane. This leads to activation of the sperm calcium channel CatSper, which results in sperm activation. Alternative splicing of this gene results in two transcript variants encoding the same protein. [provided by RefSeq, Jan 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402075 | ABHD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407219 | ABHD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402075 | Transient overexpression lysate of abhydrolase domain containing 2 (ABHD2), transcript variant 1 |
CNY 3,080.00 |
|
LY407219 | Transient overexpression lysate of abhydrolase domain containing 2 (ABHD2), transcript variant 2 |
CNY 3,080.00 |
|
PH305260 | ABHD2 MS Standard C13 and N15-labeled recombinant protein (NP_008942) |
CNY 19,520.00 |
|
TP305260 | Recombinant protein of human abhydrolase domain containing 2 (ABHD2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP310637 | Recombinant protein of human abhydrolase domain containing 2 (ABHD2), transcript variant 2, 20 µg |
CNY 2,900.00 |