RAE1 (NM_001015885) Human Mass Spec Standard
CAT#: PH310733
RAE1 MS Standard C13 and N15-labeled recombinant protein (NP_001015885)
View other "RAE1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RAE1 MS Standard C13 and N15-labeled recombinant protein (NP_001015885) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210733 |
Predicted MW | 41 kDa |
Protein Sequence |
>RC210733 protein sequence
Red=Cloning site Green=Tags(s) MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWE VQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPN YSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESP LKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIA FHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKK NYIFLRNAAEELKPRNKK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001015885 |
RefSeq Size | 1839 |
RefSeq ORF | 1104 |
Synonyms | dJ481F12.3; dJ800J21.1; Gle2; MIG14; Mnrp41; MRNP41 |
Locus ID | 8480 |
Cytogenetics | 20q13.31 |
Summary | Mutations in the Schizosaccharomyces pombe Rae1 and Saccharomyces cerevisiae Gle2 genes have been shown to result in accumulation of poly(A)-containing mRNA in the nucleus, suggesting that the encoded proteins are involved in RNA export. The protein encoded by this gene is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418550 | RAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423133 | RAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418550 | Transient overexpression lysate of RAE1 RNA export 1 homolog (S. pombe) (RAE1), transcript variant 1 |
CNY 3,080.00 |
|
LY423133 | Transient overexpression lysate of RAE1 RNA export 1 homolog (S. pombe) (RAE1), transcript variant 2 |
CNY 3,080.00 |
|
PH324655 | RAE1 MS Standard C13 and N15-labeled recombinant protein (NP_003601) |
CNY 19,520.00 |
|
TP310733 | Recombinant protein of human RAE1 RNA export 1 homolog (S. pombe) (RAE1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP324655 | Recombinant protein of human RAE1 RNA export 1 homolog (S. pombe) (RAE1), transcript variant 1, 20 µg |
CNY 2,900.00 |