CSK (NM_004383) Human Mass Spec Standard
CAT#: PH310758
CSK MS Standard C13 and N15-labeled recombinant protein (NP_004374)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CSK MS Standard C13 and N15-labeled recombinant protein (NP_004374) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210758 |
Predicted MW | 50.7 kDa |
Protein Sequence |
>RC210758 protein sequence
Red=Cloning site Green=Tags(s) MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREG VKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSI DEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVM LGDYRGNKVAVKCIKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRS RGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPV KWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK NCWHLDAAMRPSFLQLREQLEHIKTHELHL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004374 |
RefSeq Size | 2755 |
RefSeq ORF | 1350 |
Locus ID | 1445 |
Cytogenetics | 15q24.1 |
Summary | The protein encoded by this gene is involved in multiple pathways, including the regulation of Src family kinases. It plays an important role in T-cell activation through its association with the protein encoded by the protein tyrosine phosphatase, non-receptor type 22 (PTPN22) gene. This protein also phosphorylates C-terminal tyrosine residues on multiple substrates, including the protein encoded by the SRC proto-oncogene, non-receptor tyrosine kinase gene. Phosphorylation suppresses the kinase activity of the Src family tyrosine kinases. An intronic polymorphism (rs34933034) in this gene has been found to affect B-cell activation and is associated with systemic lupus erythematosus (SLE). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Chemokine signaling pathway, Epithelial cell signaling in Helicobacter pylori infection, Neurotrophin signaling pathway, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401395 | CSK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426695 | CSK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401395 | Transient overexpression lysate of c-src tyrosine kinase (CSK), transcript variant 1 |
CNY 3,080.00 |
|
LY426695 | Transient overexpression lysate of c-src tyrosine kinase (CSK), transcript variant 2 |
CNY 3,080.00 |
|
PH325740 | CSK MS Standard C13 and N15-labeled recombinant protein (NP_001120662) |
CNY 19,520.00 |
|
TP310758 | Recombinant protein of human c-src tyrosine kinase (CSK), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP325740 | Recombinant protein of human c-src tyrosine kinase (CSK), transcript variant 2, 20 µg |
CNY 2,900.00 |