GNG13 (NM_016541) Human Mass Spec Standard
CAT#: PH310828
GNG13 MS Standard C13 and N15-labeled recombinant protein (NP_057625)
View other "GNG13" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | GNG13 MS Standard C13 and N15-labeled recombinant protein (NP_057625) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210828 |
Predicted MW | 7.9 kDa |
Protein Sequence |
>RC210828 protein sequence
Red=Cloning site Green=Tags(s) MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057625 |
RefSeq Size | 1001 |
RefSeq ORF | 201 |
Synonyms | G(gamma)13; h2-35 |
Locus ID | 51764 |
Cytogenetics | 16p13.3 |
Summary | Heterotrimeric G proteins, which consist of alpha (see MIM 139320), beta (see MIM 139380), and gamma subunits, function as signal transducers for the 7-transmembrane-helix G protein-coupled receptors. GNG13 is a gamma subunit that is expressed in taste, retinal, and neuronal tissues and plays a key role in taste transduction (Li et al., 2006 [PubMed 16473877]).[supplied by OMIM, Oct 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Chemokine signaling pathway, Taste transduction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413914 | GNG13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413914 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 13 (GNG13) |
CNY 3,080.00 |
|
TP310828 | Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 13 (GNG13), 20 µg |
CNY 2,900.00 |