PLA2G12B (NM_032562) Human Mass Spec Standard
CAT#: PH310905
PLA2G12B MS Standard C13 and N15-labeled recombinant protein (NP_115951)
View other "PLA2G12B" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PLA2G12B MS Standard C13 and N15-labeled recombinant protein (NP_115951) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210905 |
Predicted MW | 21.7 kDa |
Protein Sequence |
>RC210905 protein sequence
Red=Cloning site Green=Tags(s) MKLASGFLVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCRY GKAPMPRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSI CSDLKRSLGFVSKVEAACDSLVDTVFNTVWTLGCRPFMNSQRAACICAEEEKEEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_115951 |
RefSeq Size | 1092 |
RefSeq ORF | 585 |
Synonyms | FKSG71; GXIIB; GXIIIsPLA2; PLA2G13; sPLA2-GXIIB |
Locus ID | 84647 |
Cytogenetics | 10q22.1 |
Summary | The protein encoded by this gene belongs to the phospholipase A2 (PLA2) group of enzymes, which function in glycolipid hydrolysis with the release of free fatty acids and lysophospholipids. This family member has altered phospholipid-binding properties and is catalytically inactive. The protein is secreted, and together with microsomal triglyceride transfer protein, it functions to regulate HNF4alpha-induced hepatitis C virus infectivity. The expression of this gene is down-regulated in various tumors, suggesting that it may function as a negative regulator of tumor progression. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Protein Families | Secreted Protein |
Protein Pathways | alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409997 | PLA2G12B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409997 | Transient overexpression lysate of phospholipase A2, group XIIB (PLA2G12B) |
CNY 3,080.00 |
|
TP310905 | Recombinant protein of human phospholipase A2, group XIIB (PLA2G12B), 20 µg |
CNY 2,900.00 |
其它PLA2G12B产品