SUMF1 (NM_182760) Human Mass Spec Standard
CAT#: PH311092
SUMF1 MS Standard C13 and N15-labeled recombinant protein (NP_877437)
View other "SUMF1" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | SUMF1 MS Standard C13 and N15-labeled recombinant protein (NP_877437) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211092 |
Predicted MW | 40.6 kDa |
Protein Sequence |
>RC211092 protein sequence
Red=Cloning site Green=Tags(s) MAAPALGLVCGRCPELGLVLLLLLLSLLCGAAGSQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRY SREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFV NSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVS WNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAP VDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARS QNTPDSSASNLGFRCAADRLPTMD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_877437 |
RefSeq Size | 2179 |
RefSeq ORF | 1122 |
Synonyms | AAPA3037; FGE; UNQ3037 |
Locus ID | 285362 |
Cytogenetics | 3p26.1 |
Summary | This gene encodes an enzyme that catalyzes the hydrolysis of sulfate esters by oxidizing a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also known as C-alpha-formylglycine. Mutations in this gene cause multiple sulfatase deficiency, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405331 | SUMF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431307 | SUMF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431311 | SUMF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405331 | Transient overexpression lysate of sulfatase modifying factor 1 (SUMF1), transcript variant 1 |
CNY 3,080.00 |
|
LY431307 | Transient overexpression lysate of sulfatase modifying factor 1 (SUMF1), transcript variant 2 |
CNY 3,080.00 |
|
LY431311 | Transient overexpression lysate of sulfatase modifying factor 1 (SUMF1), transcript variant 3 |
CNY 3,080.00 |
|
TP311092 | Recombinant protein of human sulfatase modifying factor 1 (SUMF1), 20 µg |
CNY 2,900.00 |
|
TP720417 | Recombinant protein of human sulfatase modifying factor 1 (SUMF1) |
CNY 3,140.00 |