ARA9 (AIP) (NM_003977) Human Mass Spec Standard
CAT#: PH311157
AIP MS Standard C13 and N15-labeled recombinant protein (NP_003968)
View other "ARA9" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | AIP MS Standard C13 and N15-labeled recombinant protein (NP_003968) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211157 |
Predicted MW | 37.7 kDa |
Protein Sequence |
>RC211157 protein sequence
Red=Cloning site Green=Tags(s) MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKL PVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDA LQQNPQPLIFHMEMLKVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLK NLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWN AQEAQADFAKVLELDPALAPVVSRELRALEARIRQKDEEDKARFRGIFSH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003968 |
RefSeq Size | 1250 |
RefSeq ORF | 990 |
Synonyms | ARA9; FKBP16; FKBP37; PITA1; SMTPHN; XAP-2; XAP2 |
Locus ID | 9049 |
Cytogenetics | 11q13.2 |
Summary | The protein encoded by this gene is a receptor for aryl hydrocarbons and a ligand-activated transcription factor. The encoded protein is found in the cytoplasm as part of a multiprotein complex, but upon binding of ligand is transported to the nucleus. This protein can regulate the expression of many xenobiotic metabolizing enzymes. Also, the encoded protein can bind specifically to and inhibit the activity of hepatitis B virus. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401308 | AIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401308 | Transient overexpression lysate of aryl hydrocarbon receptor interacting protein (AIP) |
CNY 3,080.00 |
|
TP311157 | Recombinant protein of human aryl hydrocarbon receptor interacting protein (AIP), 20 µg |
CNY 2,900.00 |