TAS2R38 (NM_176817) Human Mass Spec Standard
CAT#: PH311209
TAS2R38 MS Standard C13 and N15-labeled recombinant protein (NP_789787)
View other "TAS2R38" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TAS2R38 MS Standard C13 and N15-labeled recombinant protein (NP_789787) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211209 |
Predicted MW | 37.9 kDa |
Protein Sequence |
>RC211209 protein sequence
Red=Cloning site Green=Tags(s) MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQALSNSDCVLLCLSISRLFLHGL LFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSKLIRFSHTFLICLASWVSRKI SQMLLGIILCSCICTVLCVWCFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYLWSVPPFLLFL VSSGMLTVSLGRHMRTMKVYTRNSRDPSLEAHIKALKSLVSFFCFFVISSCVAFISVPLLILWRDKIGVM VCVGIMAACPSGHAAILISGNAKLRRAVMTILLWAQSSLKVRADHKADSRTLC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_789787 |
RefSeq Size | 1143 |
RefSeq ORF | 999 |
Synonyms | PTC; T2R38; T2R61; THIOT |
Locus ID | 5726 |
Cytogenetics | 7q34 |
Summary | This gene encodes a seven-transmembrane G protein-coupled receptor that controls the ability to taste glucosinolates, a family of bitter-tasting compounds found in plants of the Brassica sp. Synthetic compounds phenylthiocarbamide (PTC) and 6-n-propylthiouracil (PROP) have been identified as ligands for this receptor and have been used to test the genetic diversity of this gene. Although several allelic forms of this gene have been identified worldwide, there are two predominant common forms (taster and non-taster) found outside of Africa. These alleles differ at three nucleotide positions resulting in amino acid changes in the protein (A49P, A262V, and V296I) with the amino acid combination PAV identifying the taster variant (and AVI identifying the non-taster variant). [provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Taste transduction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403589 | TAS2R38 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403589 | Transient overexpression lysate of taste receptor, type 2, member 38 (TAS2R38) |
CNY 3,080.00 |
|
TP311209 | Recombinant protein of human taste receptor, type 2, member 38 (TAS2R38), 20 µg |
CNY 2,900.00 |
其它TAS2R38产品