MED9 (NM_018019) Human Mass Spec Standard
CAT#: PH311226
MED9 MS Standard C13 and N15-labeled recombinant protein (NP_060489)
View other "MED9" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | MED9 MS Standard C13 and N15-labeled recombinant protein (NP_060489) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211226 |
Predicted MW | 16.4 kDa |
Protein Sequence |
>RC211226 protein sequence
Red=Cloning site Green=Tags(s) MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPPQPPPVPAPQPQQSPAPRPQSPARAREEENYSFLPLVH NIIKCMDKDSPEVHQDLNALKSKFQEMRKLISTMPGIHLSPEQQQQQLQSLREQVRTKNELLQKYKSLCM FEIPKE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060489 |
RefSeq Size | 2222 |
RefSeq ORF | 438 |
Synonyms | MED25 |
Locus ID | 55090 |
Cytogenetics | 17p11.2 |
Summary | The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413384 | MED9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413384 | Transient overexpression lysate of mediator complex subunit 9 (MED9) |
CNY 3,080.00 |
|
TP311226 | Recombinant protein of human mediator complex subunit 9 (MED9), 20 µg |
CNY 2,900.00 |