ASC2 (PYDC1) (NM_152901) Human Mass Spec Standard
CAT#: PH311240
PYDC1 MS Standard C13 and N15-labeled recombinant protein (NP_690865)
View other "ASC2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | PYDC1 MS Standard C13 and N15-labeled recombinant protein (NP_690865) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211240 |
Predicted MW | 10.1 kDa |
Protein Sequence |
>RC211240 protein sequence
Red=Cloning site Green=Tags(s) MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVV AVLRDMRMLEEAARLQRAA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_690865 |
RefSeq Size | 582 |
RefSeq ORF | 267 |
Synonyms | ASC2; cPOP1; POP1; PYC1 |
Locus ID | 260434 |
Cytogenetics | 16p11.2 |
Summary | Associates with PYCARD/ASC and modulates its ability to collaborate with MEFV/pyrin and NLRP3/cryopyrin in NF-kappa-B and pro-caspase-1 activation. Suppresses kinase activity of NF-kappa-B inhibitor kinase (IKK) complex, expression of NF-kappa-B inducible genes and inhibits NF-kappa-B activation by cytokines and LPS.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | NOD-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407263 | PYDC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407263 | Transient overexpression lysate of PYD (pyrin domain) containing 1 (PYDC1) |
CNY 3,080.00 |
|
TP311240 | Recombinant protein of human PYD (pyrin domain) containing 1 (PYDC1), 20 µg |
CNY 2,900.00 |